COX6B2 (NM_144613) Human Recombinant Protein
CAT#: TP306224
Recombinant protein of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2), 20 µg
View other "COX6B2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206224 protein sequence
Red=Cloning site Green=Tags(s) MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS WVESWNEQIKNGIFAGKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653214 |
Locus ID | 125965 |
UniProt ID | Q6YFQ2 |
Refseq Size | 1679 |
Cytogenetics | 19q13.42 |
Refseq ORF | 264 |
Synonyms | COXVIB2; CT59 |
Summary | Connects the two COX monomers into the physiological dimeric form.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408248 | COX6B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408248 | Transient overexpression lysate of cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2) |
CNY 3080.00 |
|
PH306224 | COX6B2 MS Standard C13 and N15-labeled recombinant protein (NP_653214) |
CNY 19520.00 |