VSTM2A (NM_182546) Human Recombinant Protein
CAT#: TP306198
Recombinant protein of human V-set and transmembrane domain containing 2A (VSTM2A), 20 µg
View other "VSTM2A" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206198 protein sequence
Red=Cloning site Green=Tags(s) MGIFLVYVGFVFFSVLYVQQGLSSQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPED LDPGAEGAGAQVKLLPDRDPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEHK AQAYLKVNANSHARRMQAFEASPMWLQDMKPRKNVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQS GMETHFEPFILPLTNAPQKGQSYRVDRFMNGDF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872352 |
Locus ID | 222008 |
UniProt ID | Q8TAG5 |
Refseq Size | 3122 |
Cytogenetics | 7p11.2 |
Refseq ORF | 729 |
Synonyms | VSTM2 |
Summary | Plays a role in the regulation of the early stage of white and brown preadipocyte cell differentiation. Promotes adipogenic commitment of preadipocytes by increasing gene expression of the transcription factor PPARG in a BMP4-dependent signaling pathway.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405498 | VSTM2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405498 | Transient overexpression lysate of V-set and transmembrane domain containing 2A (VSTM2A) |
CNY 3080.00 |
|
PH306198 | VSTM2A MS Standard C13 and N15-labeled recombinant protein (NP_872352) |
CNY 19520.00 |
|
TP721227 | Purified recombinant protein of Human V-set and transmembrane domain containing 2A (VSTM2A) |
CNY 1800.00 |