Probable hydrolase PNKD (PNKD) (NM_015488) Human Recombinant Protein
CAT#: TP306179
Recombinant protein of human paroxysmal nonkinesigenic dyskinesia (PNKD), transcript variant 1, 20 µg
View other "Probable hydrolase PNKD" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206179 protein sequence
Red=Cloning site Green=Tags(s) MAAVVAATALKSRGARNARVLRGILAGATANKVSHNRTRALQSHSSSEGKEEPEPLSPELEYIPRKRGKN PMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQA QLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCH QDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLG LGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLAL QEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056303 |
Locus ID | 25953 |
UniProt ID | Q8N490 |
Refseq Size | 3129 |
Cytogenetics | 2q35 |
Refseq ORF | 1155 |
Synonyms | BRP17; DYT8; FKSG19; FPD1; KIPP1184; MR-1; MR-1S; MR1; PDC; PKND1; PNKD1; R1; TAHCCP2 |
Summary | This gene is thought to play a role in the regulation of myofibrillogenesis. Mutations in this gene have been associated with the movement disorder paroxysmal non-kinesigenic dyskinesia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411638 | PNKD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411638 | Transient overexpression lysate of paroxysmal nonkinesigenic dyskinesia (PNKD), transcript variant 2 |
CNY 3080.00 |
|
PH306179 | PNKD MS Standard C13 and N15-labeled recombinant protein (NP_056303) |
CNY 19520.00 |
其它Probable hydrolase PNKD产品