RASSF8 (NM_007211) Human Recombinant Protein
CAT#: TP306104
Recombinant protein of human Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 (RASSF8), 20 µg
View other "RASSF8" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206104 protein sequence
Red=Cloning site Green=Tags(s) MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYA SDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAKGLM DIFGKGKETEFKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLE QKIKRNDVEIEEEEFWENELQIEQENEKQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQRE VQEAQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQELEQLTKELRQVNLQ QFIQQTGTKVTVLPAEPIEIEASHADIERGIIILSDKQECKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009142 |
| Locus ID | 11228 |
| UniProt ID | Q8NHQ8 |
| Refseq Size | 2333 |
| Cytogenetics | 12p12.1 |
| Refseq ORF | 1176 |
| Synonyms | C12orf2; HOJ1 |
| Summary | This gene encodes a member of the Ras-assocation domain family (RASSF) of tumor suppressor proteins. This gene is essential for maintaining adherens junction function in epithelial cells and has a role in epithelial cell migration. It is a lung tumor suppressor gene candidate. A chromosomal translocation t(12;22)(p11.2;q13.3) leading to the fusion of this gene and the FBLN1 gene is found in a complex type of synpolydactyly. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402108 | RASSF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431359 | RASSF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402108 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 (RASSF8), transcript variant 4 |
CNY 3080.00 |
|
| LY431359 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 (RASSF8), transcript variant 1 |
CNY 3080.00 |
|
| PH306104 | RASSF8 MS Standard C13 and N15-labeled recombinant protein (NP_009142) |
CNY 19520.00 |
