DUSP19 (NM_080876) Human Recombinant Protein
CAT#: TP306095
Recombinant protein of human dual specificity phosphatase 19 (DUSP19), transcript variant 1, 20 µg
View other "DUSP19" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206095 protein sequence
Red=Cloning site Green=Tags(s) MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIK PWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAK RKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCD RIQENSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_543152 |
| Locus ID | 142679 |
| UniProt ID | Q8WTR2 |
| Refseq Size | 5379 |
| Cytogenetics | 2q32.1 |
| Refseq ORF | 651 |
| Synonyms | DUSP17; LMWDSP3; SKRP1; TS-DSP1 |
| Summary | Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009] |
| Protein Families | Druggable Genome, Phosphatase |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
PTEN regulates invasiveness in pancreatic neuroendocrine tumors through DUSP19-mediated VEGFR3 dephosphorylation.
,null,
Journal of biomedical science
,PubMed ID 36336681
[DUSP19]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408993 | DUSP19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428032 | DUSP19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408993 | Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 1 |
CNY 3080.00 |
|
| LY428032 | Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 2 |
CNY 3080.00 |
|
| PH306095 | DUSP19 MS Standard C13 and N15-labeled recombinant protein (NP_543152) |
CNY 19520.00 |
