GUCY1A1 (NM_000856) Human Recombinant Protein
CAT#: TP306063
Recombinant protein of human guanylate cyclase 1, soluble, alpha 3 (GUCY1A3), transcript variant 1, 20 µg
View other "GUCY1A1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206063 protein sequence
Red=Cloning site Green=Tags(s) MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATMPICQDIPEKNIQESLPQRKTSRSRVY LHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV FKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRT TSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTS LFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGF TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMAVKMMELS DEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCP GFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 77.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000847 |
| Locus ID | 2982 |
| UniProt ID | Q02108 |
| Refseq Size | 9454 |
| Cytogenetics | 4q32.1 |
| Refseq ORF | 2070 |
| Synonyms | GC-S-alpha-1; GC-SA3; GCS-alpha-3; GUC1A3; GUCA3; GUCSA3; GUCY1A3; MYMY6 |
| Summary | Soluble guanylate cyclases are heterodimeric proteins that catalyze the conversion of GTP to 3',5'-cyclic GMP and pyrophosphate. The protein encoded by this gene is an alpha subunit of this complex and it interacts with a beta subunit to form the guanylate cyclase enzyme, which is activated by nitric oxide. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Jan 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Gap junction, Long-term depression, Purine metabolism, Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400301 | GUCY1A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427240 | GUCY1A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400301 | Transient overexpression lysate of guanylate cyclase 1, soluble, alpha 3 (GUCY1A3), transcript variant 1 |
CNY 3080.00 |
|
| LY427240 | Transient overexpression lysate of guanylate cyclase 1, soluble, alpha 3 (GUCY1A3), transcript variant 6 |
CNY 3080.00 |
|
| PH306063 | GUCY1A3 MS Standard C13 and N15-labeled recombinant protein (NP_000847) |
CNY 19520.00 |
其它GUCY1A1产品
