MAGEB4 (NM_002367) Human Recombinant Protein
CAT#: TP306060
Recombinant protein of human melanoma antigen family B, 4 (MAGEB4), 20 µg
View other "MAGEB4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206060 protein sequence
Red=Cloning site Green=Tags(s) MPRGQKSKLRAREKRQRTRGQTQDLKVGQPTAAEKEESPSPSSSVLRDTASSSLAFGIPQEPQREPPTTS AAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIIS KKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVSMLGPNYGNQSSAWTLPRNGLLMPLLSVIFL NGNCAREEEIWEFLNMLGIYDGKRHLIFGEPRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAHAET SKMKVLEFLAKVNDTTPNNFPLLYEEALRDEEERAGARPRVAARRGTTAMTSAYSRATSSSSSQPM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002358 |
Locus ID | 4115 |
UniProt ID | O15481 |
Refseq Size | 2266 |
Cytogenetics | Xp21.2 |
Refseq ORF | 1038 |
Synonyms | CT3.6 |
Summary | This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419379 | MAGEB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419379 | Transient overexpression lysate of melanoma antigen family B, 4 (MAGEB4) |
CNY 3080.00 |
|
PH306060 | MAGEB4 MS Standard C13 and N15-labeled recombinant protein (NP_002358) |
CNY 19520.00 |