APPL (APPL1) (NM_012096) Human Recombinant Protein
CAT#: TP306021
Recombinant protein of human adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 (APPL1), 20 µg
View other "APPL" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC206021 protein sequence 
Red=Cloning site Green=Tags(s) MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEK QRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDH DAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISF FKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRK AGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGK KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTK SETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQ VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAE LDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGE GGKKRESEA myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 79.5 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_036228 | 
| Locus ID | 26060 | 
| UniProt ID | Q9UKG1 | 
| Refseq Size | 6061 | 
| Cytogenetics | 3p14.3 | 
| Refseq ORF | 2127 | 
| Synonyms | APPL; DIP13alpha; MODY14 | 
| Summary | The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq, Jul 2008] | 
| Protein Pathways | Colorectal cancer, Pathways in cancer | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Loss-of-Function Mutations in APPL1 in Familial Diabetes Mellitus
                                                ,null,
                                                American Journal of Human Genetics
                                                ,PubMed ID 26073777
                                                [APPL1]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402145 | APPL1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402145 | Transient overexpression lysate of adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 (APPL1) | 
                                                     CNY 3080.00  | 
                                            |
| PH306021 | APPL1 MS Standard C13 and N15-labeled recombinant protein (NP_036228) | 
                                                     CNY 19520.00  | 
                                            
