SAMHD1 (NM_015474) Human Recombinant Protein
CAT#: TP306013
Recombinant protein of human SAM domain and HD domain 1 (SAMHD1), 20 µg
View other "SAMHD1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206013 protein sequence
Red=Cloning site Green=Tags(s) MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRE NEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQ FQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGH GPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPV EDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRIC ARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGEKKYRISTAIDDMEAYT KLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLD VKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFVEQLIRVYCKKVDRK SLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 72 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056289 |
| Locus ID | 25939 |
| UniProt ID | Q9Y3Z3 |
| Refseq Size | 3189 |
| Cytogenetics | 20q11.23 |
| Refseq ORF | 1878 |
| Synonyms | CHBL2; DCIP; HDDC1; hSAMHD1; MOP-5; SBBI88 |
| Summary | This gene may play a role in regulation of the innate immune response. The encoded protein is upregulated in response to viral infection and may be involved in mediation of tumor necrosis factor-alpha proinflammatory responses. Mutations in this gene have been associated with Aicardi-Goutieres syndrome. [provided by RefSeq, Mar 2010] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Conserved Herpesvirus Protein Kinases Target SAMHD1 to Facilitate Virus Replication
,Zhang, K;Lv, DW;Li, R;,
Cell Rep
,PubMed ID 31291580
[SAMHD1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414526 | SAMHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414526 | Transient overexpression lysate of SAM domain and HD domain 1 (SAMHD1) |
CNY 3080.00 |
|
| PH306013 | SAMHD1 MS Standard C13 and N15-labeled recombinant protein (NP_056289) |
CNY 19520.00 |


