THAP1 (NM_018105) Human Recombinant Protein
CAT#: TP306000
Recombinant protein of human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1, 20 µg
View other "THAP1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206000 protein sequence
Red=Cloning site Green=Tags(s) MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNK LLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVE DTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVE VPA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060575 |
Locus ID | 55145 |
UniProt ID | Q9NVV9 |
Refseq Size | 2189 |
Cytogenetics | 8p11.21 |
Refseq ORF | 639 |
Synonyms | DYT6 |
Summary | The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404715 | THAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413231 | THAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404715 | Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2 |
CNY 3080.00 |
|
LY413231 | Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1 |
CNY 3080.00 |
|
PH306000 | THAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060575) |
CNY 19520.00 |