Nudel (NDEL1) (NM_030808) Human Recombinant Protein
CAT#: TP305974
Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2, 20 µg
View other "Nudel" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205974 protein sequence
Red=Cloning site Green=Tags(s) MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGFDTAPPPPGLGSSRPSSAPGMLPLSV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_110435 |
| Locus ID | 81565 |
| UniProt ID | Q9GZM8 |
| Refseq Size | 2407 |
| Cytogenetics | 17p13.1 |
| Refseq ORF | 1035 |
| Synonyms | EOPA; MITAP1; NDE1L1; NDE2; NUDEL |
| Summary | This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Mar 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410703 | NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422448 | NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410703 | Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2 |
CNY 3080.00 |
|
| LY422448 | Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1 |
CNY 3080.00 |
|
| PH305974 | NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_110435) |
CNY 19520.00 |
|
| PH312323 | NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_001020750) |
CNY 19520.00 |
|
| TP312323 | Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1, 20 µg |
CNY 2900.00 |
