CTRP5 (C1QTNF5) (NM_015645) Human Recombinant Protein
CAT#: TP305968
Purified recombinant protein of Homo sapiens C1q and tumor necrosis factor related protein 5 (C1QTNF5), 20 µg
View other "CTRP5" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205968 representing NM_015645
Red=Cloning site Green=Tags(s) MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGR PGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVT GKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVG VGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056460 |
| Locus ID | 114902 |
| UniProt ID | Q9BXJ0 |
| Refseq Size | 3927 |
| Cytogenetics | 11q23.3 |
| Refseq ORF | 729 |
| Synonyms | CTRP5; MFRP |
| Summary | This gene encodes a member of a family of proteins that function as components of basement membranes and may play a role in cell adhesion. Mutations in this gene have been associated with late-onset retinal degeneration. The protein may be encoded by either a bicistronic transcript including sequence from the upstream membrane frizzled-related protein gene (MFRP), or by a monocistronic transcript expressed from an internal promoter. [provided by RefSeq, Jun 2013] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414426 | C1QTNF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414426 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 5 (C1QTNF5) |
CNY 3080.00 |
|
| PH305968 | C1QTNF5 MS Standard C13 and N15-labeled recombinant protein (NP_056460) |
CNY 14250.00 |
|
| TP701010 | Purified recombinant protein of Human C1q and tumor necrosis factor related protein 5 (C1QTNF5), mutant (S163R), expressed in HEK293 cells, 20ug |
CNY 6650.00 |
|
| TP701081 | Purified recombinant protein of Human C1q and tumor necrosis factor related protein 5 (C1QTNF5), Ser16-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
