CRIP2 (NM_001312) Human Recombinant Protein
CAT#: TP305938
Recombinant protein of human cysteine-rich protein 2 (CRIP2), 20 µg
View other "CRIP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205938 protein sequence
Red=Cloning site Green=Tags(s) MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVT SLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001303 |
Locus ID | 1397 |
UniProt ID | P52943 |
Refseq Size | 1247 |
Cytogenetics | 14q32.33 |
Refseq ORF | 624 |
Synonyms | CRIP; CRP2; ESP1 |
Summary | This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420019 | CRIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420019 | Transient overexpression lysate of cysteine-rich protein 2 (CRIP2) |
CNY 3080.00 |
|
PH305938 | CRIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001303) |
CNY 19520.00 |