Myosin Light Chain 2 (MYL2) (NM_000432) Human Recombinant Protein
CAT#: TP305932L
Recombinant protein of human myosin, light chain 2, regulatory, cardiac, slow (MYL2), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 6193.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205932 protein sequence
Red=Cloning site Green=Tags(s) MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000423 |
| Locus ID | 4633 |
| UniProt ID | P10916 |
| Refseq Size | 855 |
| Cytogenetics | 12q24.11 |
| Refseq ORF | 498 |
| Synonyms | CMH10; MLC-2s/v; MLC2 |
| Summary | Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
| FAQs |
| SDS |
其它Myosin Light Chain 2产品

