CCDC23 (SVBP) (NM_199342) Human Recombinant Protein
CAT#: TP305925
Recombinant protein of human coiled-coil domain containing 23 (CCDC23), 20 µg
View other "CCDC23" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205925 representing NM_199342
Red=Cloning site Green=Tags(s) MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_955374 |
Locus ID | 374969 |
UniProt ID | Q8N300 |
Refseq Size | 684 |
Cytogenetics | 1p34.2 |
Refseq ORF | 198 |
Synonyms | CCDC23; NEDAHM |
Summary | Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin (PubMed:29146869). Also required to enhance the solubility and secretion of VASH1 and VASH2 (PubMed:20736312, PubMed:27879017).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403705 | CCDC23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403705 | Transient overexpression lysate of coiled-coil domain containing 23 (CCDC23) |
CNY 3080.00 |
|
PH305925 | CCDC23 MS Standard C13 and N15-labeled recombinant protein (NP_955374) |
CNY 19520.00 |