MTP18 (MTFP1) (NM_016498) Human Recombinant Protein
CAT#: TP305922
Purified recombinant protein of Homo sapiens mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "MTP18" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205922 protein sequence
Red=Cloning site Green=Tags(s) MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPE AGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHP IDRSVDFLLDSSLRKLYPTVGKPSSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057582 |
| Locus ID | 51537 |
| UniProt ID | Q9UDX5 |
| Refseq Size | 1298 |
| Cytogenetics | 22q12.2 |
| Refseq ORF | 498 |
| Synonyms | HSPC242; MTP18 |
| Summary | MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423990 | MTFP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423990 | Transient overexpression lysate of mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| PH305922 | MTP18 MS Standard C13 and N15-labeled recombinant protein (NP_057582) |
CNY 14250.00 |
