MTP18 (MTFP1) (NM_016498) Human Recombinant Protein
CAT#: TP305922
Purified recombinant protein of Homo sapiens mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "MTP18" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205922 protein sequence
Red=Cloning site Green=Tags(s) MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPE AGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHP IDRSVDFLLDSSLRKLYPTVGKPSSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057582 |
Locus ID | 51537 |
UniProt ID | Q9UDX5 |
Refseq Size | 1298 |
Cytogenetics | 22q12.2 |
Refseq ORF | 498 |
Synonyms | HSPC242; MTP18 |
Summary | MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423990 | MTFP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423990 | Transient overexpression lysate of mitochondrial protein 18 kDa (MTP18), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
PH305922 | MTP18 MS Standard C13 and N15-labeled recombinant protein (NP_057582) |
CNY 14250.00 |