CLIC5 (NM_016929) Human Recombinant Protein
CAT#: TP305906
Recombinant protein of human chloride intracellular channel 5 (CLIC5), transcript variant 2, 20 µg
View other "CLIC5" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205906 protein sequence
Red=Cloning site Green=Tags(s) MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGT HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERG LTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE MTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_058625 |
| Locus ID | 53405 |
| UniProt ID | Q9NZA1 |
| Refseq Size | 5752 |
| Cytogenetics | 6p21.1 |
| Refseq ORF | 753 |
| Synonyms | DFNB102; DFNB103; MST130; MSTP130 |
| Summary | This gene encodes a member of the chloride intracellular channel (CLIC) family of chloride ion channels. The encoded protein associates with actin-based cytoskeletal structures and may play a role in multiple processes including hair cell stereocilia formation, myoblast proliferation and glomerular podocyte and endothelial cell maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
| Protein Families | Druggable Genome, Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402589 | CLIC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426442 | CLIC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402589 | Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 2 |
CNY 3080.00 |
|
| LY426442 | Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 1 |
CNY 3080.00 |
|
| PH305906 | CLIC5 MS Standard C13 and N15-labeled recombinant protein (NP_058625) |
CNY 19520.00 |
|
| TP720188 | Recombinant protein of human chloride intracellular channel 5 (CLIC5), transcript variant 1 |
CNY 1800.00 |
