CASTOR1 (NM_001037666) Human Recombinant Protein
CAT#: TP305868
Recombinant protein of human hypothetical protein LOC652968 (LOC652968), 20 µg
View other "CASTOR1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205868 protein sequence
Red=Cloning site Green=Tags(s) MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQ VAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQE FDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHS TPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGI VAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032755 |
Locus ID | 652968 |
UniProt ID | Q8WTX7 |
Refseq Size | 1644 |
Cytogenetics | 22q12.2 |
Refseq ORF | 987 |
Synonyms | GATSL3 |
Summary | Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421975 | GATSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421975 | Transient overexpression lysate of GATS protein-like 3 (GATSL3) |
CNY 3080.00 |
|
PH305868 | GATSL3 MS Standard C13 and N15-labeled recombinant protein (NP_001032755) |
CNY 19520.00 |
其它CASTOR1产品