WSB1 (NM_015626) Human Recombinant Protein
CAT#: TP305839
Recombinant protein of human WD repeat and SOCS box-containing 1 (WSB1), transcript variant 1, 20 µg
View other "WSB1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205839 protein sequence
Red=Cloning site Green=Tags(s) MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNF LLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQ LLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVL RGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV YIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAP LSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYR I myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056441 |
| Locus ID | 26118 |
| UniProt ID | Q9Y6I7 |
| Refseq Size | 2849 |
| Cytogenetics | 17q11.1 |
| Refseq ORF | 1263 |
| Synonyms | SWIP1; WSB-1 |
| Summary | This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408739 | WSB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414461 | WSB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408739 | Transient overexpression lysate of WD repeat and SOCS box-containing 1 (WSB1), transcript variant 2 |
CNY 3080.00 |
|
| LY414461 | Transient overexpression lysate of WD repeat and SOCS box-containing 1 (WSB1), transcript variant 1 |
CNY 3080.00 |
|
| PH305839 | WSB1 MS Standard C13 and N15-labeled recombinant protein (NP_056441) |
CNY 19520.00 |
