RPA34 (RPA2) (NM_002946) Human Recombinant Protein
CAT#: TP305715
Recombinant protein of human replication protein A2, 32kDa (RPA2), 20 µg
View other "RPA34" proteins (3)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC205715 protein sequence Red=Cloning site Green=Tags(s) MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVE ISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKS LVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Tag | C-Myc/DDK | 
| Predicted MW | 29.1 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_002937 | 
| Locus ID | 6118 | 
| UniProt ID | P15927 | 
| Refseq Size | 1819 | 
| Cytogenetics | 1p35.3 | 
| Refseq ORF | 810 | 
| Synonyms | REPA2; RP-A p32; RP-A p34; RPA32 | 
| Summary | This gene encodes a subunit of the heterotrimeric Replication Protein A (RPA) complex, which binds to single-stranded DNA (ssDNA), forming a nucleoprotein complex that plays an important role in DNA metabolism, being involved in DNA replication, repair, recombination, telomere maintenance, and co-ordinating the cellular response to DNA damage through activation of the ataxia telangiectasia and Rad3-related protein (ATR) kinase. The RPA complex protects single-stranded DNA from nucleases, prevents formation of secondary structures that would interfere with repair, and co-ordinates the recruitment and departure of different genome maintenance factors. The heterotrimeric complex has two different modes of ssDNA binding, a low-affinity and high-affinity mode, determined by which oligonucleotide/oligosaccharide-binding (OB) domains of the complex are utilized, and differing in the length of DNA bound. This subunit contains a single OB domain that participates in high-affinity DNA binding and also contains a winged helix domain at its carboxy terminus, which interacts with many genome maintenance protein. Post-translational modifications of the RPA complex also plays a role in co-ordinating different damage response pathways. [provided by RefSeq, Sep 2017] | 
| Protein Families | Druggable Genome, Stem cell - Pluripotency | 
| Protein Pathways | DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| WASp modulates RPA function on single-stranded DNA in response to replication stress and DNA damage
                                                ,null,
                                                Nature Communications
                                                ,PubMed ID 35768435
                                                [RPA2] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401031 | RPA2 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY401031 | Transient overexpression lysate of replication protein A2, 32kDa (RPA2) | CNY 3080.00 | |
| PH305715 | RPA2 MS Standard C13 and N15-labeled recombinant protein (NP_002937) | CNY 19520.00 | 


 
                         热销推荐
热销推荐

 
        