Alkaline Phosphatase (ALPL) (NM_000478) Human Recombinant Protein
CAT#: TP305692
Recombinant protein of human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1, 20 µg
View other "Alkaline Phosphatase" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205692 protein sequence
Red=Cloning site Green=Tags(s) MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAA RILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMH NIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDP HNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALH EAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACI GANLGHCAPASSAGSLAAGPLLLALALYPLSVLF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000469 |
| Locus ID | 249 |
| UniProt ID | P05186 |
| Refseq Size | 2606 |
| Cytogenetics | 1p36.12 |
| Refseq ORF | 1572 |
| Synonyms | AP-TNAP; APTNAP; HOPS; HPPA; HPPC; HPPI; HPPO; TNALP; TNAP; TNSALP |
| Summary | This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects. [provided by RefSeq, Oct 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Folate biosynthesis, Metabolic pathways |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Multiplexed single-molecule enzyme activity analysis for counting disease-related proteins in biological samples
,Sakamoto, S;Komatsu, T;Watanabe, R;Zhang, Y;Inoue, T;Kawaguchi, M;Nakagawa, H;Ueno, T;Okusaka, T;Honda, K;Noji, H;Urano, Y;,
Sci Adv
,PubMed ID 32195342
[ALPL]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400165 | ALPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426804 | ALPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433101 | ALPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400165 | Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 |
CNY 3080.00 |
|
| LY426804 | Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 2 |
CNY 3080.00 |
|
| LY433101 | Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 3 |
CNY 3080.00 |
|
| PH305692 | ALPL MS Standard C13 and N15-labeled recombinant protein (NP_000469) |
CNY 19520.00 |
|
| TP720457 | Recombinant protein of human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 |
CNY 3140.00 |
|
| TP760508 | Purified recombinant protein of Human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它Alkaline Phosphatase产品

