Moesin (MSN) (NM_002444) Human Recombinant Protein
CAT#: TP305674
Recombinant protein of human moesin (MSN), 20 µg
View other "Moesin" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC205674 protein sequence 
Red=Cloning site Green=Tags(s) MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDV RKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKE VHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKN KKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEA SADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLR QIRQGNTKQRIDEFESM myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 67.6 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_002435 | 
| Locus ID | 4478 | 
| UniProt ID | P26038 | 
| Refseq Size | 3981 | 
| Cytogenetics | Xq12 | 
| Refseq ORF | 1731 | 
| Synonyms | HEL70; IMD50 | 
| Summary | Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Leukocyte transendothelial migration, Regulation of actin cytoskeleton | 
Citations (2)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                MAP4K4 regulates integrin-FERM binding to control endothelial cell motility.
                                                ,null,
                                                Nature
                                                ,PubMed ID 25799996
                                                [MSN]
                                                 | 
                                        
| 
                                                Are ERM (ezrin/radixin/moesin) proteins targets for autoantibodies in demyelinating neuropathies?
                                                ,Miyaji, K;Shahrizaila, N;Umapathi, T;Chan, YC;Hirata, K;Yuki, N;,
                                                Hum. Immunol.
                                                ,PubMed ID 25286001
                                                [MSN]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419318 | MSN HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY419318 | Transient overexpression lysate of moesin (MSN) | 
                                                     CNY 3080.00  | 
                                            |
| PH305674 | MSN MS Standard C13 and N15-labeled recombinant protein (NP_002435) | 
                                                     CNY 19520.00  | 
                                            |
| TP710366 | Purified recombinant protein of human moesin (MSN), full length, with C-terminal DDK tag, expressed in sf9, 20ug | 
                                                     CNY 4020.00  | 
                                            
