Proapoptotic Caspase Adaptor Protein (MZB1) (NM_016459) Human Recombinant Protein
CAT#: TP305659
Recombinant protein of human hypothetical protein MGC29506 (MGC29506), 20 µg
View other "Proapoptotic Caspase Adaptor Protein" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205659 protein sequence
Red=Cloning site Green=Tags(s) MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETK LHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLS RTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057543 |
Locus ID | 51237 |
UniProt ID | Q8WU39 |
Refseq Size | 845 |
Cytogenetics | 5q31.2 |
Refseq ORF | 567 |
Synonyms | MEDA-7; PACAP; pERp1 |
Summary | Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity (By similarity). Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402553 | MZB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402553 | Transient overexpression lysate of plasma cell-induced ER protein 1 (MGC29506) |
CNY 3080.00 |
|
PH305659 | MGC29506 MS Standard C13 and N15-labeled recombinant protein (NP_057543) |
CNY 19520.00 |
其它Proapoptotic Caspase Adaptor Protein产品