TMEM59 (NM_004872) Human Recombinant Protein
CAT#: TP305624
Recombinant protein of human transmembrane protein 59 (TMEM59), 20 µg
View other "TMEM59" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205624 protein sequence
Red=Cloning site Green=Tags(s) MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYAC QRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHL LFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSSD LQMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGD LEFMNEQKLNRYPASSLVVVRSKTEDHEEAGPLPTKVNLAHSEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004863 |
| Locus ID | 9528 |
| UniProt ID | Q9BXS4 |
| Refseq Size | 1709 |
| Cytogenetics | 1p32.3 |
| Refseq ORF | 972 |
| Synonyms | C1orf8; DCF1; HSPC001; PRO195; UNQ169 |
| Summary | This gene encodes a protein shown to regulate autophagy in response to bacterial infection. This protein may also regulate the retention of amyloid precursor protein (APP) in the Golgi apparatus through its control of APP glycosylation. Overexpression of this protein has been found to promote apoptosis in a glioma cell line. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417690 | TMEM59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417690 | Transient overexpression lysate of transmembrane protein 59 (TMEM59) |
CNY 3080.00 |
|
| PH305624 | TMEM59 MS Standard C13 and N15-labeled recombinant protein (NP_004863) |
CNY 19520.00 |

