BRUNOL6 (CELF6) (NM_052840) Human Recombinant Protein
CAT#: TP305606
Recombinant protein of human bruno-like 6, RNA binding protein (Drosophila) (BRUNOL6), 20 µg
View other "BRUNOL6" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205606 protein sequence
Red=Cloning site Green=Tags(s) MTAAPGGSAQPAGPGPRLGFSTADSGVGMSGLNPGPAVPMKDHDAIKLFVGQIPRGLDEQDLKPLFEEFG RIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPAASEGRGEDRKLFVGM LGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVK LADTDRERALRRMQQMAGHLGAFHPAPLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVA AFSLVAAPLLPAAAANSPPGSGPGTLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLSPYPAQSPGVA DPLQQAYAGMHHYAAAYPSAYAPVSTAFPQQPSALPQQQREGPEGCNLFIYHLPQEFGDAELIQTFLPFG AVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKAQLKRPKDANRPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443072 |
Locus ID | 60677 |
UniProt ID | Q96J87 |
Refseq Size | 3418 |
Cytogenetics | 15q23 |
Refseq ORF | 1443 |
Synonyms | BRUNOL6 |
Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409451 | CELF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433113 | CELF6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409451 | Transient overexpression lysate of bruno-like 6, RNA binding protein (Drosophila) (BRUNOL6) |
CNY 3080.00 |
|
LY433113 | Transient overexpression lysate of CUGBP, Elav-like family member 6 (CELF6), transcript variant 2 |
CNY 3080.00 |
|
PH305606 | CELF6 MS Standard C13 and N15-labeled recombinant protein (NP_443072) |
CNY 19520.00 |
其它BRUNOL6产品