AKAP associated Sperm Protein (ROPN1L) (NM_031916) Human Recombinant Protein
CAT#: TP305543
Recombinant protein of human ropporin 1-like (ROPN1L), 20 µg
View other "AKAP associated Sperm Protein" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205543 protein sequence
Red=Cloning site Green=Tags(s) MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKT DTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGS LNTALKHLCEILTDDREGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSD FFFPKRKLLESIENSEDVGH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114122 |
Locus ID | 83853 |
UniProt ID | Q96C74 |
Refseq Size | 1093 |
Cytogenetics | 5p15.2 |
Refseq ORF | 690 |
Synonyms | ASP; RSPH11 |
Summary | This gene encodes a member of the ropporin family. The encoded protein is present in sperm and interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
其它AKAP associated Sperm Protein产品