PEA15 (NM_003768) Human Recombinant Protein
CAT#: TP305507
Recombinant protein of human phosphoprotein enriched in astrocytes 15 (PEA15), 20 µg
View other "PEA15" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205507 protein sequence
Red=Cloning site Green=Tags(s) MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003759 |
| Locus ID | 8682 |
| UniProt ID | Q15121 |
| Refseq Size | 2509 |
| Cytogenetics | 1q23.2 |
| Refseq ORF | 390 |
| Synonyms | HMAT1; HUMMAT1H; MAT1; MAT1H; PEA-15; PED; PED-PEA15; PED/PEA15 |
| Summary | This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401240 | PEA15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401240 | Transient overexpression lysate of phosphoprotein enriched in astrocytes 15 (PEA15) |
CNY 3080.00 |
|
| PH305507 | PEA15 MS Standard C13 and N15-labeled recombinant protein (NP_003759) |
CNY 19520.00 |
|
| TP720922 | Purified recombinant protein of Human phosphoprotein enriched in astrocytes 15 (PEA15) |
CNY 1800.00 |


