ATE1 (NM_007041) Human Recombinant Protein
CAT#: TP305461
Recombinant protein of human arginyltransferase 1 (ATE1), transcript variant 2, 20 µg
View other "ATE1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205461 protein sequence
Red=Cloning site Green=Tags(s) MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQT CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDL KTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKE IRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRLVPVSFE DPEFKSSFSQSFSLYVKYQVAIHQDPPDECGKTEFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKI IAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQK DPSEEAAVLQYASLVGQKCSERMLLFRN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_008972 |
| Locus ID | 11101 |
| UniProt ID | O95260 |
| Refseq Size | 4930 |
| Cytogenetics | 10q26.13 |
| Refseq ORF | 1554 |
| Summary | This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416240 | ATE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424305 | ATE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY416240 | Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 2 |
CNY 3080.00 |
|
| LY424305 | Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 1 |
CNY 4840.00 |
|
| PH305461 | ATE1 MS Standard C13 and N15-labeled recombinant protein (NP_008972) |
CNY 19520.00 |
