PPP3R2 (NM_147180) Human Recombinant Protein
CAT#: TP305406
Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform (PPP3R2), 20 µg
View other "PPP3R2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205406 protein sequence
Red=Cloning site Green=Tags(s) MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGD GEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTI IILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_671709 |
| Locus ID | 5535 |
| UniProt ID | Q96LZ3 |
| Refseq Size | 3401 |
| Cytogenetics | 9q31.1 |
| Refseq ORF | 519 |
| Synonyms | PPP3RL |
| Summary | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Phosphatase |
| Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407775 | PPP3R2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407775 | Transient overexpression lysate of protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform (PPP3R2) |
CNY 3080.00 |
|
| PH305406 | PPP3R2 MS Standard C13 and N15-labeled recombinant protein (NP_671709) |
CNY 19520.00 |
