ID2 (NM_002166) Human Recombinant Protein
CAT#: TP305324
Recombinant protein of human inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2), 20 µg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC205324 protein sequence 
Red=Cloning site Green=Tags(s) MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 14.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_002157 | 
| Locus ID | 3398 | 
| UniProt ID | Q02363 | 
| Refseq Size | 1402 | 
| Cytogenetics | 2p25.1 | 
| Refseq ORF | 402 | 
| Synonyms | bHLHb26; GIG8; ID2A; ID2H | 
| Summary | The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011] | 
| Protein Families | ES Cell Differentiation/IPS, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors | 
| Protein Pathways | TGF-beta signaling pathway | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400786 | ID2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400786 | Transient overexpression lysate of inhibitor of DNA binding 2, dominant negative helix-loop-helix protein (ID2) | 
                                                     CNY 3080.00  | 
                                            |
| PH305324 | ID2 MS Standard C13 and N15-labeled recombinant protein (NP_002157) | 
                                                     CNY 19520.00  | 
                                            
