NEUROD2 (NM_006160) Human Recombinant Protein
CAT#: TP305293
Recombinant protein of human neurogenic differentiation 2 (NEUROD2), 20 µg
View other "NEUROD2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205293 protein sequence
Red=Cloning site Green=Tags(s) MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPLRGEEGTEATL AEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKGGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAA LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQL NSRNFLTEQGADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAA AGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVR GGVHSENLLSYDMHLHHDRGPMYEELNAFFHN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006151 |
Locus ID | 4761 |
UniProt ID | Q15784 |
Refseq Size | 3048 |
Cytogenetics | 17q12 |
Refseq ORF | 1146 |
Synonyms | bHLHa1; DEE72; EIEE72; NDRF |
Summary | This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416831 | NEUROD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416831 | Transient overexpression lysate of neurogenic differentiation 2 (NEUROD2) |
CNY 3080.00 |
|
PH305293 | NEUROD2 MS Standard C13 and N15-labeled recombinant protein (NP_006151) |
CNY 19520.00 |
|
TP761758 | Purified recombinant protein of Human neurogenic differentiation 2 (NEUROD2), full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它NEUROD2产品