CRHBP (NM_001882) Human Recombinant Protein
CAT#: TP305258
Recombinant protein of human corticotropin releasing hormone binding protein (CRHBP), 20 µg
View other "CRHBP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205258 representing NM_001882
Red=Cloning site Green=Tags(s) MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001873 |
| Locus ID | 1393 |
| UniProt ID | P24387 |
| Refseq Size | 1854 |
| Cytogenetics | 5q13.3 |
| Refseq ORF | 966 |
| Synonyms | CRF-BP; CRFBP |
| Summary | Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419679 | CRHBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419679 | Transient overexpression lysate of corticotropin releasing hormone binding protein (CRHBP) |
CNY 3080.00 |
|
| PH305258 | CRHBP MS Standard C13 and N15-labeled recombinant protein (NP_001873) |
CNY 19520.00 |
