ENOX1 (NM_017993) Human Recombinant Protein
CAT＃: TP305232
Recombinant protein of human ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 1, 20 µg
View other "ENOX1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205232 protein sequence
Red=Cloning site Green=Tags(s) MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK RWKLCAFEGIKTT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 73.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060463 |
| Locus ID | 55068 |
| UniProt ID | Q8TC92 |
| Refseq Size | 3047 |
| Cytogenetics | 13q14.11 |
| Refseq ORF | 1929 |
| Synonyms | bA64J21.1; cCNOX; CNOX; PIG38 |
| Summary | The protein encoded by this gene is involved in plasma membrane electron transport pathways. The encoded protein has both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity. The two activities cycle with a periodicity of 24 minutes, with one activity being at its peak when the other is at its lowest. [provided by RefSeq, Dec 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402636 | ENOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426824 | ENOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402636 | Transient overexpression lysate of ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 1 |
CNY 3080.00 |
|
| LY426824 | Transient overexpression lysate of ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 2 |
CNY 3080.00 |
|
| PH305232 | ENOX1 MS Standard C13 and N15-labeled recombinant protein (NP_060463) |
CNY 19520.00 |
|
| PH326055 | ENOX1 MS Standard C13 and N15-labeled recombinant protein (NP_001121087) |
CNY 19520.00 |
|
| TP326055 | Recombinant protein of human ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 2, 20 µg |
CNY 2900.00 |
