SNRPG (NM_003096) Human Recombinant Protein
CAT#: TP305113
Recombinant protein of human small nuclear ribonucleoprotein polypeptide G (SNRPG), 20 µg
View other "SNRPG" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205113 protein sequence
Red=Cloning site Green=Tags(s) MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML EALERV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 8.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003087 |
| Locus ID | 6637 |
| UniProt ID | P62308 |
| Refseq Size | 606 |
| Cytogenetics | 2p13.3 |
| Refseq ORF | 228 |
| Synonyms | Sm-G; SMG |
| Summary | The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401078 | SNRPG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401078 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide G (SNRPG) |
CNY 3080.00 |
|
| PH305113 | SNRPG MS Standard C13 and N15-labeled recombinant protein (NP_003087) |
CNY 19520.00 |
