TCPTP (PTPN2) (NM_080423) Human Recombinant Protein
CAT#: TP305090
Recombinant protein of human protein tyrosine phosphatase, non-receptor type 2 (PTPN2), transcript variant 3, 20 µg
View other "TCPTP" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205090 protein sequence
Red=Cloning site Green=Tags(s) MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYIN ASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHG PAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIK GDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSERPRL TDT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_536348 |
| Locus ID | 5771 |
| UniProt ID | P17706 |
| Refseq Size | 1619 |
| Cytogenetics | 18p11.21 |
| Refseq ORF | 1059 |
| Synonyms | PTN2; PTPT; TC-PTP; TCELLPTP; TCPTP |
| Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling. Multiple alternatively spliced transcript variants encoding different isoforms have been found. Two highly related but distinctly processed pseudogenes that localize to chromosomes 1 and 13, respectively, have been reported. [provided by RefSeq, May 2011] |
| Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409168 | PTPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419088 | PTPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409168 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 2 (PTPN2), transcript variant 3 |
CNY 3080.00 |
|
| LY419088 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 2 (PTPN2), transcript variant 1 |
CNY 3080.00 |
|
| PH305090 | PTPN2 MS Standard C13 and N15-labeled recombinant protein (NP_536348) |
CNY 19520.00 |
