SH2D1B (NM_053282) Human Recombinant Protein
CAT#: TP305069
Recombinant protein of human SH2 domain containing 1B (SH2D1B), 20 µg
View other "SH2D1B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205069 protein sequence
Red=Cloning site Green=Tags(s) MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_444512 |
| Locus ID | 117157 |
| UniProt ID | O14796 |
| Refseq Size | 2553 |
| Cytogenetics | 1q23.3 |
| Refseq ORF | 396 |
| Synonyms | EAT2 |
| Summary | By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM, Mar 2008] |
| Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409300 | SH2D1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409300 | Transient overexpression lysate of SH2 domain containing 1B (SH2D1B) |
CNY 3080.00 |
|
| PH305069 | SH2D1B MS Standard C13 and N15-labeled recombinant protein (NP_444512) |
CNY 19520.00 |
