NIPSNAP3B (NM_018376) Human Recombinant Protein
CAT#: TP305012
Recombinant protein of human nipsnap homolog 3B (C. elegans) (NIPSNAP3B), 20 µg
View other "NIPSNAP3B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205012 protein sequence
Red=Cloning site Green=Tags(s) MLVLRSGLTKALASRTLAPQVCSSFATGPRQYDGTFYEFRTYYLKPSNMNAFMENLKKNIHLRTSYSELV GFWSVEFGGRTNKVFHIWKYDNFAHRAEVRKALANCKEWQEQSIIPNLARIDKQETEITYLIPWSKLEKP PKEGVYELAVFQMKPGGPALWGDAFERAINAHVNLGYTKVVGVFHTEYGELNRVHVLWWNESADSRAAGR HKSHEDPRVVAAVRESVNYLVSQQNMLLIPASFSPLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060846 |
| Locus ID | 55335 |
| UniProt ID | Q9BS92 |
| Refseq Size | 1781 |
| Cytogenetics | 9q31.1 |
| Refseq ORF | 741 |
| Synonyms | FP944; NIPSNAP3; SNAP1 |
| Summary | NIPSNAP3B belongs to a family of proteins with putative roles in vesicular trafficking (Buechler et al., 2004 [PubMed 15177564]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413071 | NIPSNAP3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413071 | Transient overexpression lysate of nipsnap homolog 3B (C. elegans) (NIPSNAP3B) |
CNY 3080.00 |
|
| PH305012 | NIPSNAP3B MS Standard C13 and N15-labeled recombinant protein (NP_060846) |
CNY 19520.00 |
其它NIPSNAP3B产品
