RDH11 (NM_016026) Human Recombinant Protein
CAT#: TP305003
Recombinant protein of human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 20 µg
View other "RDH11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205003 protein sequence
Red=Cloning site Green=Tags(s) MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYL ACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTAD GFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANI LFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILS GNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLSID myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | MS digestion standard (PMID: 26606514) |
| Reference Data | |
| RefSeq | NP_057110 |
| Locus ID | 51109 |
| UniProt ID | Q8TC12 |
| Refseq Size | 2587 |
| Cytogenetics | 14q24.1 |
| Refseq ORF | 954 |
| Synonyms | ARSDR1; CGI82; HCBP12; MDT1; PSDR1; RALR1; RDJCSS; SCALD; SDR7C1 |
| Summary | The protein encoded by this gene is an NADPH-dependent retinal reductase and a short-chain dehydrogenase/reductase. The encoded protein has no steroid dehydrogenase activity. [provided by RefSeq, Nov 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Retinol metabolism |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Sample matrix has a major impact on accuracy of peptide quantification: Assessment of calibrator and internal standard selection and method validation
,Arnold, SL;Stevison, F;Isoherranen, N;,
Analytical chemistry
,PubMed ID 26606514
[RDH11]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402488 | RDH11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402488 | Transient overexpression lysate of retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11) |
CNY 3080.00 |
|
| PH305003 | RDH11 MS Standard C13 and N15-labeled recombinant protein (NP_057110) |
CNY 19520.00 |


