TPST2 (NM_001008566) Human Recombinant Protein
CAT#: TP304969
Recombinant protein of human tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 1, 20 µg
View other "TPST2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204969 protein sequence
Red=Cloning site Green=Tags(s) MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPL IFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDC LTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLS KIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLK GDYKTPANLKGYFQVNQNSTSSHLGSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008566 |
Locus ID | 8459 |
UniProt ID | O60704 |
Refseq Size | 2018 |
Cytogenetics | 22q12.1 |
Refseq ORF | 1131 |
Synonyms | TANGO13B; TPST-2 |
Summary | The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418564 | TPST2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423338 | TPST2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418564 | Transient overexpression lysate of tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 2 |
CNY 3080.00 |
|
LY423338 | Transient overexpression lysate of tyrosylprotein sulfotransferase 2 (TPST2), transcript variant 1 |
CNY 3080.00 |
|
PH304969 | TPST2 MS Standard C13 and N15-labeled recombinant protein (NP_001008566) |
CNY 19520.00 |