NDUFV1 (NM_007103) Human Recombinant Protein
CAT#: TP304954
Recombinant protein of human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, 20 µg
View other "NDUFV1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 6281.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC204954 protein sequence 
Red=Cloning site Green=Tags(s) MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILL KGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLE GCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEET ALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISG HVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLG TAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE GHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 48.5 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_009034 | 
| Locus ID | 4723 | 
| UniProt ID | P49821 | 
| Refseq Size | 1631 | 
| Cytogenetics | 11q13.2 | 
| Refseq ORF | 1392 | 
| Synonyms | CI-51K; CI51KD; MC1DN4; UQOR1 | 
| Summary | The mitochondrial respiratory chain provides energy to cells via oxidative phosphorylation and consists of four membrane-bound electron-transporting protein complexes (I-IV) and an ATP synthase (complex V). This gene encodes a 51 kDa subunit of the NADH:ubiquinone oxidoreductase complex I; a large complex with at least 45 nuclear and mitochondrial encoded subunits that liberates electrons from NADH and channels them to ubiquinone. This subunit carries the NADH-binding site as well as flavin mononucleotide (FMN)- and Fe-S-biding sites. Defects in complex I are a common cause of mitochondrial dysfunction; a syndrome that occurs in approximately 1 in 10,000 live births. Mitochondrial complex I deficiency is linked to myopathies, encephalomyopathies, and neurodegenerative disorders such as Parkinson's disease and Leigh syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2009] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC416198 | NDUFV1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY416198 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| PH304954 | NDUFV1 MS Standard C13 and N15-labeled recombinant protein (NP_009034) | 
                                                     CNY 19520.00  | 
                                            
