Claudin 3 (CLDN3) (NM_001306) Human Recombinant Protein
CAT#: TP304882M
Purified recombinant protein of Human claudin 3 (CLDN3), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 100ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204882 protein sequence
Red=Cloning site Green=Tags(s) MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLL ALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSAN TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASL GTGYDRKDYV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.3 kDa |
| Concentration | >50 ug/mL as determined by microplate Bradford method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001297 |
| Locus ID | 1365 |
| UniProt ID | O15551, Q75L79 |
| Refseq Size | 1318 |
| Cytogenetics | 7q11.23 |
| Refseq ORF | 660 |
| Synonyms | C7orf1; CPE-R2; CPETR2; HRVP1; RVP1 |
| Summary | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
Documents
| FAQs |
| SDS |
其它Claudin 3产品
