XPA (NM_000380) Human Recombinant Protein
CAT#: TP304872
Purified recombinant protein of Human xeroderma pigmentosum, complementation group A (XPA), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204872 protein sequence
Red=Cloning site Green=Tags(s) MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIID TGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLIT KTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQEN REKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000371 |
| Locus ID | 7507 |
| UniProt ID | P23025 |
| Refseq Size | 1491 |
| Cytogenetics | 9q22.33 |
| Refseq ORF | 819 |
| Synonyms | XP1; XPAC |
| Summary | This gene encodes a zinc finger protein plays a central role in nucleotide excision repair (NER), a specialized type of DNA repair. NER is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens and chemotherapeutic drugs. The encoded protein interacts with DNA and several NER proteins, acting as a scaffold to assemble the NER incision complex at sites of DNA damage. Mutations in this gene cause Xeroderma pigmentosum complementation group A (XP-A), an autosomal recessive skin disorder featuring hypersensitivity to sunlight and increased risk for skin cancer. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Nucleotide excision repair |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Evaluation and modulation of DNA lesion bypass in an SV40 large T antigen‐based in vitro replication system
,null,
FEBS Open Bio
,PubMed ID 33512058
[XPA]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424749 | XPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424749 | Transient overexpression lysate of xeroderma pigmentosum, complementation group A (XPA), transcript variant 1 |
CNY 3080.00 |
|
| PH304872 | XPA MS Standard C13 and N15-labeled recombinant protein (NP_000371) |
CNY 19520.00 |
|
| TP762531 | Purified recombinant protein of Human xeroderma pigmentosum, complementation group A (XPA), transcript variant 1, 50ug |
CNY 2480.00 |
