RPB11 (POLR2J) (NM_006234) Human Recombinant Protein
CAT#: TP304819M
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa (POLR2J), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204819 protein sequence
Red=Cloning site Green=Tags(s) MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHK IIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006225 |
| Locus ID | 5439 |
| UniProt ID | P52435 |
| Refseq Size | 991 |
| Cytogenetics | 7q22.1 |
| Refseq ORF | 351 |
| Synonyms | hRPB14; POLR2J1; RPB11; RPB11A; RPB11m |
| Summary | This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
| FAQs |
| SDS |
