HSPC014 (POMP) (NM_015932) Human Recombinant Protein
CAT#: TP304812
Recombinant protein of human proteasome maturation protein (POMP), 20 µg
View other "HSPC014" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204812 protein sequence
Red=Cloning site Green=Tags(s) MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057016 |
| Locus ID | 51371 |
| UniProt ID | Q9Y244 |
| Refseq Size | 1477 |
| Cytogenetics | 13q12.3 |
| Refseq ORF | 423 |
| Synonyms | C13orf12; HSPC014; PNAS-110; PRAAS2; UMP1 |
| Summary | The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.[provided by RefSeq, Aug 2010] |
| Protein Pathways | Proteasome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402471 | POMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402471 | Transient overexpression lysate of proteasome maturation protein (POMP) |
CNY 3080.00 |
|
| PH304812 | POMP MS Standard C13 and N15-labeled recombinant protein (NP_057016) |
CNY 19520.00 |
其它HSPC014产品
