Gemin 8 (GEMIN8) (NM_001042480) Human Recombinant Protein
CAT#: TP304795
Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 1, 20 µg
View other "Gemin 8" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204795 protein sequence
Red=Cloning site Green=Tags(s) MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYLPSALLPQSSYDNEA AYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSRIQASTKEDQALSKEEEMETESDAEVECDLSNMEIT EELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYCNTRRSVEAPTERPGERRQAEMKRLYGDSAA KIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035945 |
| Locus ID | 54960 |
| UniProt ID | Q9NWZ8 |
| Refseq Size | 3089 |
| Cytogenetics | Xp22.2 |
| Refseq ORF | 726 |
| Synonyms | FAM51A1 |
| Summary | The protein encoded by this gene is part of the SMN complex, which is necessary for spliceosomal snRNP assembly in the cytoplasm and pre-mRNA splicing in the nucleus. The encoded protein binds to both SMN1 and the GEMIN6/GEMIN7 heterodimer, mediating their interaction. This protein is found in nuclear Gemini of Cajal bodies (gems) and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413420 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420932 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420933 | GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413420 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 3 |
CNY 3080.00 |
|
| LY420932 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 2 |
CNY 3080.00 |
|
| LY420933 | Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 1 |
CNY 3080.00 |
|
| PH300165 | GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035944) |
CNY 19520.00 |
|
| PH304795 | GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035945) |
CNY 19520.00 |
|
| PH313444 | GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_060326) |
CNY 19520.00 |
|
| TP300165 | Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP313444 | Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Gemin 8产品
