SH2D1A (NM_002351) Human Recombinant Protein
CAT#: TP304723
Recombinant protein of human SH2 domain protein 1A (SH2D1A), transcript variant 1, 20 µg
View other "SH2D1A" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204723 protein sequence
Red=Cloning site Green=Tags(s) MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAP GVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002342 |
| Locus ID | 4068 |
| UniProt ID | O60880 |
| Refseq Size | 2523 |
| Cytogenetics | Xq25 |
| Refseq ORF | 384 |
| Synonyms | DSHP; EBVS; IMD5; LYP; MTCP1; SAP; SAP/SH2D1A; XLP; XLPD; XLPD1 |
| Summary | This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400845 | SH2D1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400845 | Transient overexpression lysate of SH2 domain protein 1A (SH2D1A), transcript variant 1 |
CNY 3080.00 |
|
| PH304723 | SH2D1A MS Standard C13 and N15-labeled recombinant protein (NP_002342) |
CNY 19520.00 |
|
| TP720893 | Purified recombinant protein of Human SH2 domain containing 1A (SH2D1A), transcript variant 1 |
CNY 1800.00 |
