Neuroligin 4 (NLGN4X) (NM_181332) Human Recombinant Protein
CAT＃: TP304671
Recombinant protein of human neuroligin 4, X-linked (NLGN4X), transcript variant 2, 20 µg
View other "Neuroligin 4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204671 protein sequence
Red=Cloning site Green=Tags(s) MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNTNYGKIRGLRTPLPNEILGPV EQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQ DQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGF LSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQS GTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIP DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHG DEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWS KYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPA KIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK DKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDD IPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 91.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_851849 |
| Locus ID | 57502 |
| UniProt ID | Q8N0W4 |
| Refseq Size | 5889 |
| Cytogenetics | Xp22.32-p22.31 |
| Refseq ORF | 2448 |
| Synonyms | ASPGX2; AUTSX2; HLNX; HNL4X; NLGN4 |
| Summary | This gene encodes a member of the type-B carboxylesterase/lipase protein family. The encoded protein belongs to a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs large homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405787 | NLGN4X HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412367 | NLGN4X HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405787 | Transient overexpression lysate of neuroligin 4, X-linked (NLGN4X), transcript variant 2 |
CNY 3080.00 |
|
| LY412367 | Transient overexpression lysate of neuroligin 4, X-linked (NLGN4X), transcript variant 1 |
CNY 3080.00 |
|
| PH304671 | NLGN4X MS Standard C13 and N15-labeled recombinant protein (NP_851849) |
CNY 19520.00 |
|
| PH322932 | NLGN4X MS Standard C13 and N15-labeled recombinant protein (NP_065793) |
CNY 19520.00 |
|
| TP322932 | Recombinant protein of human neuroligin 4, X-linked (NLGN4X), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Neuroligin 4产品
