RBP4 (NM_006744) Human Recombinant Protein
CAT#: TP304635
Recombinant protein of human retinol binding protein 4, plasma (RBP4), 20 µg
View other "RBP4" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204635 protein sequence
Red=Cloning site Green=Tags(s) MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006735 |
| Locus ID | 5950 |
| UniProt ID | P02753 |
| Refseq Size | 941 |
| Cytogenetics | 10q23.33 |
| Refseq ORF | 603 |
| Synonyms | MCOPCB10; RDCCAS |
| Summary | This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402016 | RBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402016 | Transient overexpression lysate of retinol binding protein 4, plasma (RBP4) |
CNY 3080.00 |
|
| PH304635 | RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735) |
CNY 19520.00 |
|
| TP720147 | Recombinant protein of human retinol binding protein 4, plasma (RBP4) |
CNY 1800.00 |
