ZMYND19 (NM_138462) Human Recombinant Protein
CAT#: TP304509
Recombinant protein of human zinc finger, MYND-type containing 19 (ZMYND19), 20 µg
View other "ZMYND19" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204509 protein sequence
Red=Cloning site Green=Tags(s) MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHE LLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQ FPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKK HCRERKRPFQHELEPER myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612471 |
Locus ID | 116225 |
UniProt ID | Q96E35 |
Refseq Size | 1371 |
Cytogenetics | 9q34.3 |
Refseq ORF | 681 |
Synonyms | MIZIP |
Summary | ZMYND19 is a MYND zinc finger domain-containing protein that binds to the C terminus of melanin-concentrating hormone receptor-1 (MCHR1; MIM 601751) (Bachner et al., 2002 [PubMed 12208518]), and to the N termini of alpha-tubulin (TUBA1; MIM 191110), and beta-tubulin (TUBB; MIM 191130) (Francke et al., 2005 [PubMed 16039987]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408589 | ZMYND19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408589 | Transient overexpression lysate of zinc finger, MYND-type containing 19 (ZMYND19) |
CNY 3080.00 |
|
PH304509 | ZMYND19 MS Standard C13 and N15-labeled recombinant protein (NP_612471) |
CNY 19520.00 |
|
TP720252 | Recombinant protein of human zinc finger, MYND-type containing 19 (ZMYND19) |
CNY 1800.00 |
其它ZMYND19产品