CD32B (FCGR2B) (NM_001002275) Human Recombinant Protein
CAT#: TP304496
Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4, 20 µg
View other "CD32B" proteins (14)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204496 representing NM_001002275
Red=Cloning site Green=Tags(s) MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLT CRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHP EFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV TITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDE ADKVGAENTITYSLLMHPDALEEPDDQNRI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001002275 |
| Locus ID | 2213 |
| UniProt ID | P31994 |
| Refseq Size | 1630 |
| Cytogenetics | 1q23.3 |
| Refseq ORF | 930 |
| Synonyms | CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2 |
| Summary | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
| Protein Families | ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400365 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC401309 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424200 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424201 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434147 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400365 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4 |
CNY 3080.00 |
|
| LY401309 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 1 |
CNY 3080.00 |
|
| LY424200 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2 |
CNY 3080.00 |
|
| LY424201 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 3 |
CNY 3080.00 |
|
| LY434147 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 5 |
CNY 3080.00 |
|
| PH304496 | FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002275) |
CNY 19520.00 |
|
| PH319569 | FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002273) |
CNY 19520.00 |
|
| TP319569 | Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720664 | Purified recombinant protein of Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4 |
CNY 3140.00 |
